ACTH (7 – 38), human

Ontores Biotechnologies

Category : ACTH and Related Peptides

Purity : 95%

Sequence (One Letter Code) : FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE

Sequence (Three letter Code) : H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH

Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity.

Mol Wt : 3659.2

Shipping Standard

Buy now

0.5 mg

£91.00 / €127.40 ONP10007

All prices shown are exclusive of VAT