Adrenocorticotropic Hormone (ACTH) (1-39), human

Ontores Biotechnologies

Category : ACTH and Related Peptides

Purity : 95%

Sequence (One Letter Code) : SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

Sequence (Three letter Code) : {SER}{TYR}{SER}{MET}{GLU}{HIS}{PHE}{ARG}{TRP}{GLY}{LYS}{PRO}{VAL}{GLY}{LYS}{LYS}{ARG}{ARG}{PRO}{VAL}{LYS}{VAL}{TYR}{PRO}{ASN}{GLY}{ALA}{GLU}{ASP}{GLU}{SER}{ALA}{GLU}{ALA}{PHE}{PRO}{LEU}{GLU}{PHE}

Adrenocorticotropic hormones (ACTH). ACTH stimulates the adrenal cortex and the secretion of glucocorticoids such as cortisol. Another name for ACTH is corticotropin.

Mol Wt : 4541.13

Shipping Standard

Buy now

1 mg

£279.50 / €391.30 ONP10005

All prices shown are exclusive of VAT