Adrenocorticotropic Hormone (ACTH) (1-39), rat

Ontores Biotechnologies

Category : ACTH and Related Peptides

Purity : 95%

Sequence (One Letter Code) : SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF

Sequence (Three letter Code) : {SER}{TYR}{SER}{MET}{GLU}{HIS}{PHE}{ARG}{TRP}{GLY}{LYS}{PRO}{VAL}{GLY}{LYS}{LYS}{ARG}{ARG}{PRO}{VAL}{LYS}{VAL}{TYR}{PRO}{ASN}{VAL}{ALA}{GLU}{ASN}{GLU}{SER}{ALA}{GLU}{ALA}{PHE}{PRO}{LEU}{GLU}{PHE}

Peptide fragments of ACTH (1-39) were formed during in vitro incubation of the peptide with membrane preparations. ACTH (1-39) were isolated by high pressure liquid chromatography, and peptide fragments of ACTH (1-39) characterized by determination of amino acid composition and NH2- terminal residue.

Mol Wt : 4582.5

Shipping Standard

Buy now

1 mg

£273.00 / €382.20 ONP10002

All prices shown are exclusive of VAT