Adrenomedullin (AM) (13-52), human

Ontores Biotechnologies

Category : Adrenomedullin Peptides

Purity : 95%

Sequence (One Letter Code) : SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2

Sequence (Three letter Code) : {SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}{CYS}{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY}{TYR}-NH2

Adrenomedullin (13-52) is a 40 amino acid peptide with one intramolecular disulfide bridge, Adrenomedullin (13-52) is a high affinity ligand for the adrenomedullin receptor.

Mol Wt : 4533.2

Shipping Standard

Buy now

0.5 mg

£278.20 / €389.48 ONP10011

All prices shown are exclusive of VAT