Adrenomedullin (AM) (22-52), human

Ontores Biotechnologies

Category : Adrenomedullin Peptides

Purity : 95%

Sequence (One Letter Code) : TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2

Sequence (Three letter Code) : {THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY}{TYR}-NH2

AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.

Mol Wt : 3576.1

Shipping Standard

Buy now

0.5 mg

£130.00 / €182.00 ONP10010

All prices shown are exclusive of VAT