Amylin, human, amide

Ontores Biotechnologies

Category : Amylin Peptides

Purity : 95%

Sequence (One Letter Code) : KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2

Sequence (Three letter Code) : {LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{HIS}{SER}{SER}{ASN}{ASN}{PHE}{GLY}{ALA}{ILE}{LEU}{SER}{SER}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2

Amylin, a 37-amino acid polypeptide that is structurally related to calcitonin, is secreted from the B cells of the pancreas. Amylin has anoretic effects in rats. Amylin may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. Amylin blocks the activation of glycogen synthase by insulin.

Mol Wt : 3903.28

Shipping Standard

Buy now

0.5 mg

£182.00 / €254.80 ONP10015

All prices shown are exclusive of VAT