?-Amyloid (1-34)

Ontores Biotechnologies

Category : Signal Transduction Peptides

Purity : 95%

Sequence (One Letter Code) : DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL

Sequence (Three letter Code) : {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}

This is a fragment of beta-amyloid peptide. It has amino acids 1 through 34.

Mol Wt : 3787.2

Shipping Standard

Buy now

0.5 mg

£169.00 / €236.60 ONP10836

All prices shown are exclusive of VAT