MCP 4 Human

ApexBio

Short Summary : Monocyte Chemotactic Protein-4 Human Recombinant (CCL13)

Purity : Greater than 96.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Molecular Weight : 8.6 kDa

Accession Number : Q99616

Alternative Name/s : Small inducible cytokine A13, CCL13, Monocyte chemotactic protein 4, MCP-4, Monocyte chemoattractant protein 4, CK-beta-10, NCC-1, chemokine (C-C motif) ligand 13, NCC1, CKb10, SCYL1, SCYA13, MGC17134.

Source : Escherichia Coli.

Amino Acid Sequence/Note: QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT.

Appearance/Format : Sterile Filtered White lyophilized (freeze-dried) powder.

Storage/Note : Lyophilized MCP-4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MCP-4 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Formulation/Form : The protein was lyophilized from a concentrated (1mg/ml) sterile solution in 20mM PB, pH 7.4, 130mM NaCl.

Background/Description : Monocyte Chemotactic Protein-4 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 75 amino acids and having a molecular mass of 8.6 kDa. The MCP-4 is purified by proprietary chromatographic techniques.

Shipping Standard

Buy now

2μg

£30.00 / €42.00 P2122-.002

10μg

£84.00 / €117.60 P2122-.01

1mg

£3,240.00 / €4,536.00 P2122-1

All prices shown are exclusive of VAT