MCP 4 Human
Short Summary : Monocyte Chemotactic Protein-4 Human Recombinant (CCL13)
Purity : Greater than 96.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Molecular Weight : 8.6 kDa
Accession Number : Q99616
Alternative Name/s : Small inducible cytokine A13, CCL13, Monocyte chemotactic protein 4, MCP-4, Monocyte chemoattractant protein 4, CK-beta-10, NCC-1, chemokine (C-C motif) ligand 13, NCC1, CKb10, SCYL1, SCYA13, MGC17134.
Source : Escherichia Coli.
Amino Acid Sequence/Note: QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT.
Appearance/Format : Sterile Filtered White lyophilized (freeze-dried) powder.
Storage/Note : Lyophilized MCP-4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MCP-4 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation/Form : The protein was lyophilized from a concentrated (1mg/ml) sterile solution in 20mM PB, pH 7.4, 130mM NaCl.
Background/Description : Monocyte Chemotactic Protein-4 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 75 amino acids and having a molecular mass of 8.6 kDa. The MCP-4 is purified by proprietary chromatographic techniques.
Shipping | Standard |
---|
Buy now
All prices shown are exclusive of VAT