IP 10 Human
Short Summary : IP-10 Human Recombinant (CXCL10)
Purity : Greater than 95.0% as determined by SDS-PAGE.
Molecular Weight : 8.6 kDa
Accession Number : P02778
Alternative Name/s : Small inducible cytokine B10, CXCL10, 10 kDa interferon-gamma-induced protein, Gamma-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCYB10, gIP-10.
Source : Escherichia Coli.
Amino Acid Sequence/Note: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKEMSKRSP.
Appearance/Format : Sterile Filtered White lyophilized (freeze-dried) powder.
Storage/Note : Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation/Form : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Background/Description : IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.
| Shipping | Standard |
|---|
Buy now
All prices shown are exclusive of VAT