IL 13 Human

Short Summary : Interleukin-13 Human Recombinant

Purity : Greater than 95% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Molecular Weight : 12 kDa

Accession Number : P35225

Alternative Name/s : NC30, ALRH, BHR1, P600, IL-13, MGC116786, MGC116788, MGC116789.

Source : Escherichia Coli.

Amino Acid Sequence/Note: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN.

Appearance/Format : Sterile Filtered White lyophilized (freeze-dried) powder.

Storage/Note : Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Formulation/Form : The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose.

Background/Description : Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques.