IL 19 Mouse

Short Summary : Interleukin-19 Mouse Recombinant

Purity : Greater than 95.0% as determined by SDS-PAGE.

Molecular Weight : 17.7 kDa

Accession Number : Q8CJ70

Alternative Name/s : Interleukin-19, IL-19, Il19.

Source : Escherichia Coli.

Amino Acid Sequence/Note: MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA.

Appearance/Format : Sterile Filtered White lyophilized (freeze-dried) powder.

Storage/Note : Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Formulation/Form : Lyophilized from a sterile filtered aqueous solution containing 5mM Na3PO4 and 150mM NaCl, pH 7.5.

Background/Description : Interleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. The IL-19 is purified by proprietary chromatographic techniques.