IL 8 Rabbit

Short Summary : Interleukin-8 Rabbit Recombinant (CXCL8)

Purity : Greater than 90% as determined by SDS-PAGE.

Molecular Weight : 12.24 kDa

Accession Number : P19874

Alternative Name/s : IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, Emoctakin, K60, NAF, LECT, LUCT, 3-10C, LYNAP, SCYB8, TSG-1, AMCF-I, b-ENAP.

Source : Escherichia Coli.

Amino Acid Sequence/Note: AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV QIFLKRAEQQES.

Appearance/Format : Sterile Filtered colorless solution.

Storage/Note : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.

Formulation/Form : The IL-8 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.

Background/Description : IL-8 Rabbit Recombinant is a full length secreted protein (79 amino acids – a.a. 23-101). The IL-8 is expressed in E.Coli. and fused to a N-terminal His tag, having a total MW of 12.24kDa.