MedChemExpress

View website

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.

Recent products

C-Type Natriuretic Peptide (CNP) (1-22), human

Price range: £145.60 through £4,228.80 / €203.84 – €5,920.32 Standard

View and order

Atrial Natriuretic Peptide (ANP) (1-28), rat (TFA)

Price range: £262.40 through £1,428.80 / €367.36 – €2,000.32 Standard

View and order

Atrial Natriuretic Peptide (ANP) (1-28), rat

Price range: £262.40 through £1,428.80 / €367.36 – €2,000.32 Standard

View and order

Atrial Natriuretic Peptide (ANP) (1-28), human, porcine (Acetate)

Price range: £262.40 through £9,868.80 / €367.36 – €13,816.32 Standard

View and order

HAE

Price range: £315.20 through £1,539.20 / €441.28 – €2,154.88 Standard

View and order

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Price range: £489.60 through £2,624.00 / €685.44 – €3,673.60 Standard

View and order

HAEGT

Price range: £280.00 through £1,188.80 / €392.00 – €1,664.32 Standard

View and order

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Price range: £489.60 through £2,624.00 / €685.44 – €3,673.60 Standard

View and order

HAEGTFT

Price range: £315.20 through £1,539.20 / €441.28 – €2,154.88 Standard

View and order

SDV-Exendin-3/4

Price range: £612.80 through £1,924.80 / €857.92 – €2,694.72 Standard

View and order

HAEGTFTSD

Price range: £315.20 through £1,539.20 / €441.28 – €2,154.88 Standard

View and order

{Val1}-Exendin-3/4

Price range: £489.60 through £2,624.00 / €685.44 – €3,673.60 Standard

View and order

HAEGTFTSDVS

Price range: £315.20 through £1,539.20 / €441.28 – €2,154.88 Standard

View and order

Exendin-3/4 (59-86)

Price range: £489.60 through £2,624.00 / €685.44 – €3,673.60 Standard

View and order

LL-37, Human (TFA)

Price range: £379.20 through £13,444.80 / €530.88 – €18,822.72 Standard

View and order

Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA)

Price range: £204.80 through £1,400.00 / €286.72 – €1,960.00 Standard

View and order
1 … 105 106 107 … 917